INDIA:+91 70828-15469 | USA: +1 (209) 210-2102 info@theastromaster.com
Paralysis

Paralysis

Paralysis is related to the nervous system which shows loss of muscle functions in your body completely or partially. Medically it occurs when message exchange goes wrong between muscles and brain or clot in blood that stuck in veins causing stroke to the nervous system.

In many cases, it has been noticed that paralysis can be one side of the body or one side of a specific area whether it right or left. Many causes are there to occur like injury in the spinal cord, stroke, nerve injury, multiple sclerosis, peripheral neuropathy, poliomyelitis, due to Parkinson, cerebral palsy and spinal Bifida etc. 

In astrology, Sun (Immunity and vital energy), Moon (rules the mental disorders that cause nervous breakdown or paralysis), Mercury (rules nervous system or veins), Mars (rules surgery, injury, muscles and energy to move), Saturn (chronic disease and obstruction), Rahu/Ketu (cause affliction and sudden occurrence) are the main planet causing paralysis.

House representing paralysis are Ascendant (head, brain, and self or entire body), fifth (cerebral system, intellect or secondary significator of mental disorders), sixth (house of diseases), eighth (chronic diseases), ninth (rules limbs), and twelfth (hospitalization, loss of activity, movement, vitality, and decay). The Main Sagittarius signs contribute to paralysis that rules sciatic nerve or peripheral nervous system and limbs). U. Bhadrapada, P. Bhadrapada, U. Shadha and Moola are the constellations that cause paralysis.

Kidney problems

Kidney problems

Body has two bean-shaped kidneys above your waist both side of spine covered by the rib cage. The main function of the kidney is to filter the blood to remove extra water and waste products in the form of urine that passes through ureters to bladder where it will remain stored until discretion. Kidney problems includes stones, cysts, infections or cancer and other problems due to medications.

When we talk about kidney problems, nephrons get affected that make the kidney unable to remove waste products. Kidneys help to maintain the balance of minerals and water, maintaining blood pressure by renin, helps to make vitamin D needed for bones and removes waste generated by medicines, digestion and chemicals etc.

Kidney problems are known as acute (acute renal failure) and chronic kidney diseases. Causes for acute problems are as auto-immune diseases, sepsis or severe infection, eclampsia during pregnancy, excess protein in the bloodstream due to tissues breakdown and some drugs etc. In case of chronic, chronic viral infections as hepatitis B and C and AIDS, inflammation in glomeruli, pyelonephritis, polycystic and lupus nephritis etc.

Some symptoms may be an exhibit by the native-like poor sleeping, swelling of the ankles, itchy and dry skin, weight loss due to no apparent reasons, fatigue, shortness of breath constantly, and no interest in eating and taste. In astrology, planets are responsible for kidney problems as Moon rules water, liquid, or blood), Venus (kidney and urinary system), and Jupiter (Stomach area). Constellations are like Chitra, Vishakha, Ashlesha, and Revati. Houses are sixth (house of diseases), seventh (kidneys), and eighth (chronic). The sign is Libra for kidney problems.

Blood Pressure

Blood Pressure

Normally blood travels through the body pushing against the walls of arteries and vessels at rhythmic pressure as systole and diastole but continuously remaining beyond the normal range called blood pressure that can be low or high. An instrument called a sphygmomanometer helps to measure the blood pressure that should be 120 at systolic and 80 at diastolic in healthy cases.

Mars and Moon are the primary significators of blood and the Sun for the heart. Their connection with the 06th, 08th, and 12th house cause BP. 04th, 08th, and 12th house represent the blood and if these are weak and afflicted, will give BP. Mars, Moon, and Sun, in conjunction, affliction or aspects from malefic planets like Saturn, Rahu, and Ketu are responsible for blood pressure because Saturn is known for obstructions or disturbing the planet for the normal function of the body. Afflicted Moon causes low BP but afflicted and strong Mars causes high blood pressure.

There some constellation represents low blood pressure like Moola and Purva Bhadra and few are concerned with high blood pressure like Purva Phalguni, Uttar Phalguni, and Shatbhisha. Sun under Saturn’s malefic influence, the heart’s function gets disturbed by reducing vital force energy represented by Sun that gives low blood pressure. Malefic Jupiter, a fat forming planet, in connection with the weak Sun also causes high blood pressure.


©Dr Ashok Sharma

ASTHMA PROBLEM

ASTHMA PROBLEM

Asthma is a problem related respiratory system which affects your breathing through bronchial and lungs. In this disease, air passages are inflamed and swelled producing additional mucus causing difficulty in breathing. Asthma can be mild or severe with wheezing chest pain and cough that is a life-threatening condition for an individual but in mild cases, the patient feels shortness of breath, congestion in chest and fatigue due to insufficient supply of oxygen in the body.

Extra mucus in bronchial or lungs creates a disturbance for smooth airflow and causes cough or wheezing. Causes of asthma are environmental or genetic that trigger the asthma problem or attacks. In genetic causes, asthmatic tendencies are transmitted from parents and native has no control over this but in environmental causes, native can control the triggers like pollen, pollution, allergic food and some medicines but asthma is not curable medically and native can live a normal life by changing his or her lifestyle with healthy diet and exercise.

Doctor prescribe inhalers (corticosteroids) and other medicine like tablets and cough syrups to release the extra mucus stored in bronchial or lungs for smooth airflow or breathing normally but in case of severity, anti-leukotriene or long-acting beta-agonists or hospitalization required. In astrology, mainly Moon(rules fourth house, chest and water or fluid or mucus in the body), Mars(rules infection, inflammation and muscular energy), Mercury(represents bronchial, lungs, breath and nervous system), Saturn( known for obstruction, degenerative and chronic diseases) and Rahu or Ketu ( both planets increases the severity or show no curability) are responsible for asthma.

For more detailed analysis, Jupiter also contributes to asthma because of controlling over phlegm or mucus or lungs.

Astrologically, constellations causing asthma are like P. Shadha and U. Shadha, Ardra, Ashlesha and Punarvasu. For asthma, third (rules bronchial and oxygen supply), fourth (lungs or chest), fifth (lower part of lungs and diaphragm) and eighth (severity and chronic diseases) house are responsible and signs are Gemini (rules respiratory organs and bronchial with proper supply oxygen in lungs or body), Cancer (rules forth house or chest) and Leo (lower parts of lungs, diaphragm and heart)

©Dr Ashok Sharma

PROMOTION AND TRANSFER

PROMOTION AND TRANSFER

Promotion

In a job, an individual runs to office or factor for a live hood with various routine challenges at the workplace. He works hard to fulfill the necessities of life with hope and aspiration to become successful in his life. Everyone expects rewards, recognition, status, respect, and authority at work to grow in professional life.

People start their job and move forward with daily learning resulting in a good performance with the passage of time. If an individual works hard at service and meets the desired goal set by the organization, then he becomes an asset to the company. He takes responsibilities as per his job description and functions in tune with the mission and vision of the company followed by team or subordinates. 

Now if an individual is a good performer, responsible and disciplined, the company recognizes his value and contribution towards the organization by giving extra responsibilities with more challenges to achieve higher goals as a promotion. Promotion carries three main properties like higher responsibilities, power & authority, and a goal-oriented approach that gives gains to the native in his profession.

In astrology, there are four houses that promise promotion through your planetary position in the birth chart. Now we will discuss each house and its role in promotion.

The Second House

The second house rules the financial matter, money, income from multiple sources. If the second house is under influence of auspicious planets, it will create the environment to generate income to make you finally strong. In promotion, the native gets higher salary and perks as per the job requirement because if there is any indication of increasing the income of the native in the birth chart who is in service or job, then obliviously the money or income will come through the job only.

The Sixth House

The Sixth House is seen for the enemy, debt, competitor, and service or job. At the workplace, many people work together and compete with each other to prove themselves better human resource and some team members behaves like enemies or try to harm by conspiracy. Means this house indicate that native is more competent in service or job for higher responsibilities to achieve the bigger goals set by the company and gets promoted. The strong sixth house in the birth chart promises the promotion.

The Tenth House

This house represents Karma or efforts or actions, status, achievement, honor, authority, power, and success in life through your actions, etc. Whether it is a job or business, the tenth house’s role will be the same that makes the native inclined towards work or efforts to achieve a successful life.

The Eveleth House

This house signifies income from various sources, rewards, gains, and success in all, areas of life whether it is a job, business, relationship, health or career, etc. If this house is strong and having a positive aspect and conjunction in the birth chart, it will bless the candidate with success, reward, and contented life. In my career, this house shows your gain, growth, progress or promotion, etc.

So, the second, sixth, tenth, and eleventh houses are ware seen for the promotion in career.

When will the native get promotion?

In the matter of timing of promotion, transition of the planets and combined periods (Dasha) or sub periods (Antardasha) or sub-sub periods (Partyantar) of above depicted houses are the main methods to know about the promotion.

  • The native gets promotion and growth if Saturn creates Navam Pancham yoga (Ninth- Fifth combination) from Mercury, Venus and Rahu in transition through, 01, 02nd, 06th, 09th,10yh and 11th.
  • During transit or period or sub-periods of auspicious planet related to the tenth and eleventh lords.
  • During transit or period or sub-periods of yogakarka planets.
  • Transiting Jupiter over the sign paced in tenth house gives promotion. 

Planets posited in twelfth house and theirs results

Sun- Money, status, power and courage

Moon- Touring job, change in work and intelligent

Mars- Courage, disputes, accidents and contented in career

Mercury- Intelligent but litigations causes problems at job

Jupiter- Honour, govt. service, judiciary and scholar 

Venus- Govt job, travelling and writer

Saturn- Sincere, doctor and researcher

Rahu- Rich, accidents and sharp minded

Ketu- Transfer, weak finance and tensions

Transfer

In service or job, transfer is a normal phenomenon during the tenure of service. Transfer refers the change of work place it may be along with change of residence also or without. Reasons for transfer may very like departmental, requested, integrity issues or others etc. but in transfer main point is change of place.

Astrologically, third and twelfth house are responsible in addition to houses responsible for promotion. So, 03rd, 06th, 10th and 12th to be seen for transfers but now we will discuss only 03rd and 12th because rest of we have already discussed earlier in matter of promotion.  

The Third House

Third house is a Trishdai Bhav which is considered inauspicious house and seen for courage, communication, short travel, stamina, residence change, movement and servant etc. According to Bhavat Bhavam Siddhant, this house is the eighth from the eighth house and sixth from tenth house and twelfth from fourth house in birth chart.

Normally, transfers take place due to higher responsibilities or on request with various personal reasons but in some case forceful transfer also happen. This house is the eighth from the eighth that gives struggle, obstacles by hidden enemies or team members or boss etc. just like eighth house. So, this house is basically change of place and short travel which indicate the transfers unwillingly but good thing is that if transfer take place with choice or willingly, here sixth house plays vital role and on the time of transfer third house creates connection with sixth house. Being twelfth from fourth house, indicate the loss of happiness of residence so, mainly third house contribute to transfers in the birth chart.

The Twelfth House 

This is one of the Trik Bhav which is not considered an auspicious house that signifies loss, expenditure, defamation, change of place, jail, foreign travel, decline, hospitalization and court etc. This shows the loss of your reputation, health, money and career also means loss of all areas of life even life too. 

This is third house from tenth again that indicate struggle, change of place and servant and movement etc. But important this that this house gives transfer due to some wrong deeds or against the will or defamation at work place. If this house is under auspicious influence, transfer will take place normally and under affliction, transfer is forceful or unwillingly due to negative reasons.

Being seventh from sixth house, it shows the opponents or adversity in the existing environment means sixth is for job or service but twelfth will create disturbance performing the responsibilities assign at office.

Planets posited in twelfth house and theirs results

Sun- problematic job, talented and loss from govt. side
Moon- Lucky in foreign, far from home and wise

Mars- high expenditure, businessman and disputes

Mercury- Unlucky, prosperous and restless 

Jupiter-Intelligent, no interest in job and spiritual 

Venus- Luxury life, money and expenses

Saturn- money, defamation and job at jail or hospital

Rahu- expenses, imaginative and losses

Ketu- Export-import, secret services and black magic

Planetary position in transition for transfer

  • The native gets transfer and growth if Saturn creates Navam Pancham yoga (Ninth- Fifth combination) from Mercury, Venus and Rahu in transition through, 01st, 02nd, 06th, 09th,10yh and 11th.
  • During transit or period or sub-periods of auspicious planet related to the tenth and eleventh lords.
  • During transit or period or sub-periods of Yogakarka planets.
  • Transiting Jupiter over the sign paced in tenth house gives transfer. 

©Copyright: Dr Ashok Sharma

JOB OR BUSINESS?

JOB OR BUSINESS?

This is the most common and confusing question among people. They visit the astrologer related to the queries of career whether it is job or business. In the beginning of education, an individual starts learning process and continues till he starts the profession. Some choose the career as per their interest, skill and education but many of them choose their career under environmental forces like family, poverty, no skills and other reasons etc. Finally, each of us has to choose one as business or job although many of us are there who try to run the business along with the job but the native will get success in a single path of career whether it is job or business. Our Vedic science of astrology helps here to find out the suitable career path as business or job by analysing the placement and strength of the planets in birth chart. Horoscope is the tool to know about the strength, weaknesses, potential, interest and work aptitude etc. suitable for career.

Tenth House

The tenth house of birth chart is the house indicate karmas or efforts. This house plays vital role in determining the profession whether it is job or business. In both the native do Karmas or performs action for live hood, honour, prestige, achievement, status and benefits from government etc. Whenever tenth house creates connection with any house, it adds efforts to accomplish the particular activity related to that house. For example, if lord of tenth house connects with second house then native will try or put his efforts for money and family through his speech. In the same way, if connects with fourth house, native works or gives his efforts to accumulate the property, house, jewellery and vehicle etc. and gets happiness in it. Mars becomes exalted here that gives courage, confidence, vital energy and strengths for technical work like electrical engineer and physical activity involved professions like sports, defence, police and secret service etc. Saturn is the lord of karma or actions and because of that becomes significator of tenth house and makes the native sincere, hard worker and technical bent of mind in the professional life but under malefic influence, causes delay in work, lazy, depressive, struggleful and fluctuations in business or obstacles in business. Now we will discuss about the career path or the native should go for business or job or the suitable one.

Job

Job means service or in other word an individual works for the salary or wages that need some physical or mental work. In horoscope, evaluate sixth and seventh house first and sixth house must be stronger than seventh because seventh house rules business. Sixth house is seen for service, competition, debt and enemy etc. this house is ninth from tenth house it means your efforts or karmas in service will get success but due to house of competition and enemy also, it shows competition with colleagues and feeling of enmity with people in surroundings at work place. In Kalpurusha Kundli, sixth house falls under Virgo sign ruled by Mercury that also shows service especially in intellectual aspects. This is one of the Trishdai house and Trik Bhava also so both are considered inauspicious but still sixth house gives strength to the native especially in financial matters that helps in availing loan or reduces the debts. Mars and Saturn both are the significator of this house. Saturn indicates delay in work, debt, service, struggle and subordinates whereas Mars indicates disputes, fight, injuries and accident at work place. Mercury also has rulership of sixth that is the planet indicates communication skills, intellectual capacity, logical thinking and managerial capabilities etc. Malefic planets are considered favourable results in sixth house like Sun, Mars, Saturn, Rahu and Ketu. Sun gives confidence, team spirit, courage, stamina and willingness to face the adverse situation during at work place. Mars protects the native from accidents, injuries, fights and litigation etc. whereas Saturn bless with good support with subordinates, hard work and dedication towards work. Rahu makes the cunning, diplomatically strong, enemy destroyer and reduces conspiracy against the native at work place. Under positive influence or aspect, conjunction with Yogkarka planet, gives tremendous success in job but if afflicted or under malefic influence, the native faces struggle, delay in work, accidents, litigation and accidents or obstacle in service matters etc.

Business

The word “business” derived from the word busy that indicates regularity. Business means is a trade, occupation or selling of products and service to generate a profit. In other word it is self-employment where the native is responsible to run the organization to make a profit with all ups and downs, challenges or normal routine activities. For business, seventh house is responsible just like sixth house for service or job. Seventh house is the tenth from tenth house that shows again the efforts put by the native for live hood. This is a killer house or Marka Asthana also that can give serious problems in business if afflicted or under malefic influence in the birth chart. In Kalpurusha Kundli, this house is represented by Libra sign ruled by Venus. Venus is the planet that rules materialistic success, luxuries, sexual life, entertainment and life partner. Seventh house also signifies business partner, international trade, foreign business, opponents in business, land, employment, contracts, commerce, treaties, disputes, separation and association etc. Saturn becomes exalted here that is the significator of hard work, employment and subordinates etc. which are essential for running a successful business. This is one of the square houses out of four viz.01st, 04th, 07th and 10th. According to Laghu Parashari (Verse-14 and Chapter-3), if any planet becomes the lord of square and trine at the same time provided that it has no connection with other planets, it is called yogakarka planet that gives very auspicious results during its transition and periods or sub-periods. kendratrikonpatye sambandhen parasparam | itarairaprashktaashchedwiseshfaldayak || According to Laghu Parashari (Verse-7 and Chapter-2), all the auspicious and inauspicious planets or lords of square houses becomes neutral in delivering their results. Means if a malefic planet becomes the lord of the seventh house, its negative results will be reduced. In the same way, if the benefic planet has the lordship of the seventh house, it will reduce its auspiciousness. na dishanti subham nranaam saumya kendradhipa yadi | krurashchedshubham hayete prablashchottrottram || The seventh house must be analysed properly to know about the business prospects in the birth charts. If the lord of the seventh house is having negative aspect, conjunction, weak in shadbala and degrees, inimical constellation and signs, will deliver unfavourable results in business or partnership. If strong tenth house lord has an auspicious connection with seventh, it gives rise in self-employment or business or partnership. The tenth house will fructify the results in connection with sixth and seventh whether it is business or job. Auspicious planets posited in the seventh house, indicate a smooth, obstacle-free and successful business provided they must be strong in the birth chart. Each planet has different results in this house from the career point of view. Sun becomes debilitated in this house and indicates execution problems, big ups & downs in business, losses and creativity but no confidence. Moon gives good results here in generating revenue, happiness & satisfaction in business, emotional approach and helps to grow in women related businesses etc. Mars can cause accident, injuries, enmity and less profits etc. Mercury delivers good results that make the native good decision-maker, defeater of enemies and famous in market etc. Jupiter will give good results here conditionally. If the native works hard gets success especially in intellectual works. Here, Jupiter creates an obstacle in concentrating in business or worldly affairs and diverts the native towards spirituality and social work which can be harmful to the business. Venus is the significator of this house and delivers best results in business because Venus is itself a planet of business especially in cosmetic, garments, jewellery and entertainment etc. Saturn becomes exalted here and force the native to choose the technical or medical business and makes him lazy or develops the tendency to delay the work resulting in loss of clients etc. Rahu gives cunningness, cheating and confusion in self-employment. Ketu detaches the native from money matters or business. ©Copyright: Dr Ashok Sharma